PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA011761-PA
Common NameOsI_09817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 429aa    MW: 45384.5 Da    PI: 5.9571
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA011761-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09280337562
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l ++
  BGIOSGA011761-PA 280 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSAQLTMMQRDSAGLATQ 337
                       999***************************************9999988888777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15276340IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599278341IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-10280337No hitNo description
SuperFamilySSF579596.33E-11280331No hitNo description
PfamPF001701.7E-8280338IPR004827Basic-leucine zipper domain
CDDcd147032.45E-22281332No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MNGGIGDALM QPQHVQVMSS SLPMVASTFV AEPAAAAAAA NKPRAAGLPP TPPQVFAAQR  60
AAAAAGGDVC MEESAQGGGG GLPPRKAHRR SSSDVPFGYL AGQHQLLPPK VEAGWGHLGA  120
GAGGAAAADD LFNAYLNLDG LDGLNSSDDR HDEGDSRGSS IKTNGADSSE NESEECADDT  180
RGGIRLWSAD GGERREGVKR NAAGEPATAP LARHARSLSM DSLIGKFNFT AGTAAAAGNG  240
VALGPNRFSL EFGSGEFTPS EMKKIMADEK LAEMALADPK RVKRVLANRQ SAARSKERKM  300
RYIAELEQKV QILQSEATNL SAQLTMMQRD SAGLATQNNE LKFRLHAMEQ QAQLRDALNE  360
ALTTEVQRLK LATAELGDSC SSSSLAQQIQ LNAQNQMFQL QQQQATQIPF YQLQQSQQNG  420
AAKNNESKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.181780.0callus| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA2XC020.0A2XC02_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011761-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-79bZIP family protein